PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 140aa    MW: 15860.2 Da    PI: 9.2351
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62812.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.71.7e-241056248
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                +ie+ks rqvtfskRrng++KKA+ELS+LCda+v  +++s +gkl+ 
  EPS62812.1 10 PIEDKSSRQVTFSKRRNGLFKKAKELSILCDADVGAVVVSCRGKLHR 56
                69*******************************************96 PP

2K-box15.19.3e-071031383570
       K-box  35 qRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                 +R + Ge  e+ s+ +L  Le+qLe  l +iR+ K 
  EPS62812.1 103 LRIVDGEVGEDRSVTDLAVLEKQLEAVLIQIREAKV 138
                 45666777788899*******************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.4E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.698161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-26175IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-22323IPR002100Transcription factor, MADS-box
PfamPF003198.6E-251155IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-223859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MGRRRLEIRP IEDKSSRQVT FSKRRNGLFK KAKELSILCD ADVGAVVVSC RGKLHRLCTA  60
DSLATFLRRY YSHVESKSSN SDGAPSEEQL SKHSEYITKE ELLRIVDGEV GEDRSVTDLA  120
VLEKQLEAVL IQIREAKVRL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
129RRRLEIRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012842151.12e-42PREDICTED: agamous-like MADS-box protein AGL27
TrEMBLS8DSL23e-97S8DSL2_9LAMI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10140.23e-30MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]